DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMGB3 and Sox14

DIOPT Version :10

Sequence 1:NP_001427702.1 Gene:HMGB3 / 3149 HGNCID:5004 Length:222 Species:Homo sapiens
Sequence 2:NP_476894.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster


Alignment Length:90 Identity:27/90 - (30%)
Similarity:47/90 - (52%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   108 KKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDSEKQPYITKAAKLK 172
            ||..|...|||.:.|.::....|.||....|.:...:::|:||..|..|:..:|||||.:|.||:
  Fly   180 KKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLR 244

Human   173 EKYEKDVADYKSKGKFDGAKGPAKV 197
            :.:..:..:||.:.:....:.|..:
  Fly   245 KLHMIEYPNYKYRPQKKQTRSPGSL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HMGB3NP_001427702.1 None
Sox14NP_476894.1 HMG-box_SoxC 186..261 CDD:438838 23/74 (31%)

Return to query results.
Submit another query.