DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP1 and lips-9

DIOPT Version :9

Sequence 1:NP_572245.1 Gene:PGAP1 / 31487 FlyBaseID:FBgn0029789 Length:980 Species:Drosophila melanogaster
Sequence 2:NP_496756.1 Gene:lips-9 / 174935 WormBaseID:WBGene00010267 Length:302 Species:Caenorhabditis elegans


Alignment Length:189 Identity:42/189 - (22%)
Similarity:65/189 - (34%) Gaps:41/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EPMFAKVGVRDGDQYPNYALY--YYYEGLR-QPLDPLKRRMTGAPVIFVPGNAGSYKQVRSLASV 104
            :|.:|....|...:|....:|  .|:.|.: .||..::..|          .....||||||. |
 Worm    80 KPFWAAQWFRKEGKYAENEIYSTTYFNGAQGNPLKWIEYSM----------KCEYIKQVRSLI-V 133

  Fly   105 ALRKAMSNDAGIHLDYYTIDYDEELSALYGGYLHRQQSYLKLCIRTILSIYEG-----RTEQP-- 162
            |:|  :.....:.:..:::.......|:.||.......||...:..::..|.|     |...|  
 Worm   134 AVR--LYTGRNVDVIGFSLGVPVSRKAILGGRCVDTGEYLGEPLTRVVDTYIGVAGPNRGASPQL 196

  Fly   163 ----------SIVLIGHSMGGKLAQSVLVDPAIGQHINTI--------ISISTPLDQPV 203
                      ||..|.:|:.|..:.:........|.||..        .||.|..||.|
 Worm   197 GPLSVPACALSITPICNSVNGLYSGNCPAQSEFLQDINKFAHYEGQYTYSIYTQKDQMV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP1NP_572245.1 PGAP1 79..324 CDD:285110 33/150 (22%)
lips-9NP_496756.1 Lipase_2 64..294 CDD:250789 42/189 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S163
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.