DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP1 and nhr-49

DIOPT Version :9

Sequence 1:NP_572245.1 Gene:PGAP1 / 31487 FlyBaseID:FBgn0029789 Length:980 Species:Drosophila melanogaster
Sequence 2:NP_001367039.1 Gene:nhr-49 / 172839 WormBaseID:WBGene00003639 Length:501 Species:Caenorhabditis elegans


Alignment Length:293 Identity:65/293 - (22%)
Similarity:108/293 - (36%) Gaps:91/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 PRRRQQNTVRFGAAGNWHEERRLVINKYFTNGLKGTFFDLIGLQRQE---RYRKAAIEA-----L 410
            |.....|:...|:.|...|..|.|..   ::.:.....::.....||   |||::.|.|     .
 Worm   132 PGYENGNSNGVGSNGMGQENMRTVPQ---SSSVIDALMEMEARVNQEMCNRYRRSQIFANGSGGS 193

  Fly   411 NVDDEDWLFG--------------CSAE-DNNKTGQLYCEKATSLMHLVQW---------LPNED 451
            |.:|.|...|              |:.| |.|:..:      |:|:.:|:|         |..||
 Worm   194 NGNDTDIQQGSDSGASAFAPPNRPCTTEVDLNEISR------TTLLLMVEWAKTINPFMDLSMED 252

  Fly   452 REPRSIALLDLHNLRKTYVHWTHLLVRLP----PSAKRIGYNLDIYDPKERVTDIKMPRWYTMAK 512
            :    |.||      |.|.. .||:: :|    |...|:....:.|..::..||:.     ..|.
 Worm   253 K----IILL------KNYAP-QHLIL-MPAFRSPDTTRVCLFNNTYMTRDNNTDLN-----GFAA 300

  Fly   513 LPLINETLQGTLHHRVRISEMVDPYQSIR------VIVEPLQCINPEYR---VTARICVPWAAGF 568
            ....|.|      .|| :.|:|.|.:.::      |.::.|..::||.:   .:::|.:..|   
 Worm   301 FKTSNIT------PRV-LDEIVWPMRQLQMREQEFVCLKALAFLHPEAKGLSNSSQIMIRDA--- 355

  Fly   569 ERFQTLKSF---------DQKPQLYVNVPTLVP 592
             |.:.||:.         |..|..|.|:..|.|
 Worm   356 -RNRVLKALYAFILDQMPDDAPTRYGNILLLAP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP1NP_572245.1 PGAP1 79..324 CDD:285110
nhr-49NP_001367039.1 NR_DBD_HNF4A 35..110 CDD:143518
HOLI 228..382 CDD:214658 40/187 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S163
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.