DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP1 and Epas1

DIOPT Version :9

Sequence 1:NP_572245.1 Gene:PGAP1 / 31487 FlyBaseID:FBgn0029789 Length:980 Species:Drosophila melanogaster
Sequence 2:NP_034267.3 Gene:Epas1 / 13819 MGIID:109169 Length:874 Species:Mus musculus


Alignment Length:229 Identity:47/229 - (20%)
Similarity:76/229 - (33%) Gaps:69/229 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 ALYGGYL------------HRQQSYLKLCIRTILSIYEGR-----TEQPSIVLIGHSMGGKLAQS 178
            |.:|||:            ...|....:|:..:||..|..     .:|...:...|.|.......
Mouse   311 AKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFD 375

  Fly   179 VLVDPAIGQHINTIIS------------ISTPLDQPVLNLDTQLEEFYDQTDAV----------- 220
            ...|.|:.:..|.:.:            ..||.| .:::||...:.| |:..|.           
Mouse   376 SSDDVAVTEKSNYLFTKLKEEPEELAQLAPTPGD-AIISLDFGSQNF-DEPSAYGKAILPPGQPW 438

  Fly   221 LSKLR-------TATVPTMTTNVCDSLHQRPPSVQRMAS-------QDSSARLDNVL-------L 264
            :|.||       :.::|..|....|:.....||....:|       :|..:.|:|.|       |
Mouse   439 VSGLRSHSAQSESGSLPAFTVPQADTPGNTTPSASSSSSCSTPSSPEDYYSSLENPLKIEVIEKL 503

  Fly   265 ISTGGGNRDLLVRPGLTSSRFN--DLHAMTSAIP 296
            .:.....||    ||.|.:.|:  ||..:...||
Mouse   504 FAMDTEPRD----PGSTQTDFSELDLETLAPYIP 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP1NP_572245.1 PGAP1 79..324 CDD:285110 47/229 (21%)
Epas1NP_034267.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
HLH 12..68 CDD:238036
DNA-binding. /evidence=ECO:0000269|PubMed:26245371 26..53
PAS 86..147 CDD:214512
Required for heterodimer formation with ARNT. /evidence=ECO:0000269|PubMed:26245371 171..192
PAS 241..340 CDD:238075 5/28 (18%)
PAS_3 254..341 CDD:285623 6/29 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 438..489 10/50 (20%)
NTAD 495..541 12/43 (28%)
HIF-1 516..548 CDD:288296 6/18 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 777..803
CTAD 834..874
HIF-1a_CTAD 837..873 CDD:285931
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S163
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.