DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL35 and RPL35B

DIOPT Version :10

Sequence 1:NP_572243.1 Gene:RpL35 / 31483 FlyBaseID:FBgn0029785 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_010090.1 Gene:RPL35B / 851419 SGDID:S000002295 Length:120 Species:Saccharomyces cerevisiae


Alignment Length:123 Identity:61/123 - (49%)
Similarity:90/123 - (73%) Gaps:3/123 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVVRKAIARVYIVMHQKQ 65
            |..||..|||.|.|::|..||.:||.||..|:|.|::  .|| |.||:.|||:||.|..|::::|
Yeast     1 MAGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLS--RPS-LPKIKTVRKSIACVLTVINEQQ 62

  Fly    66 KENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDANRKTLKEIRKRSVFPQRKFAVKA 123
            :|.:|:::|.|||:|.|||.|||||:|:||:..:|::.|.|:.:|:..|||||:|:||
Yeast    63 REAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVTEKQRKKQIAFPQRKYAIKA 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL35NP_572243.1 Ribosomal_L29 7..63 CDD:459954 27/55 (49%)
RPL35BNP_010090.1 Ribosomal_L29 8..60 CDD:459954 27/54 (50%)

Return to query results.
Submit another query.