DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL35 and RPL35A

DIOPT Version :9

Sequence 1:NP_001284900.1 Gene:RpL35 / 31483 FlyBaseID:FBgn0029785 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_010145.1 Gene:RPL35A / 851336 SGDID:S000002350 Length:120 Species:Saccharomyces cerevisiae


Alignment Length:123 Identity:61/123 - (49%)
Similarity:90/123 - (73%) Gaps:3/123 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVVRKAIARVYIVMHQKQ 65
            |..||..|||.|.|::|..||.:||.||..|:|.|::  .|| |.||:.|||:||.|..|::::|
Yeast     1 MAGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLS--RPS-LPKIKTVRKSIACVLTVINEQQ 62

  Fly    66 KENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDANRKTLKEIRKRSVFPQRKFAVKA 123
            :|.:|:::|.|||:|.|||.|||||:|:||:..:|::.|.|:.:|:..|||||:|:||
Yeast    63 REAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVTEKQRKKQIAFPQRKYAIKA 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL35NP_001284900.1 Ribosomal_L29 7..64 CDD:279204 27/56 (48%)
RPL35ANP_010145.1 RpmC 3..68 CDD:223333 31/67 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346364
Domainoid 1 1.000 69 1.000 Domainoid score I2293
eggNOG 1 0.900 - - E1_COG0255
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31432
Inparanoid 1 1.050 111 1.000 Inparanoid score I1373
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53927
OrthoFinder 1 1.000 - - FOG0001124
OrthoInspector 1 1.000 - - otm46728
orthoMCL 1 0.900 - - OOG6_100532
Panther 1 1.100 - - LDO PTHR45722
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1132
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.