DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL35 and AT3G09500

DIOPT Version :10

Sequence 1:NP_572243.1 Gene:RpL35 / 31483 FlyBaseID:FBgn0029785 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_187561.1 Gene:AT3G09500 / 820107 AraportID:AT3G09500 Length:123 Species:Arabidopsis thaliana


Alignment Length:122 Identity:73/122 - (59%)
Similarity:89/122 - (72%) Gaps:0/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVVRKAIARVYIVMHQKQ 65
            |.::|..|||.|.|.:|..||.|||.||..|||||||||||:|||||:||||:||:|..|..|||
plant     1 MARIKVHELREKSKSDLQNQLKELKAELALLRVAKVTGGAPNKLSKIKVVRKSIAQVLTVSSQKQ 65

  Fly    66 KENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDANRKTLKEIRKRSVFPQRKFAVK 122
            |..||:.:||||..|||||.|||||||:.|:...|:.||.:|.:|...||.||:|:|
plant    66 KSALREAYKNKKLLPLDLRPKKTRAIRRRLTKHQASLKTEREKKKEMYFPIRKYAIK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL35NP_572243.1 Ribosomal_L29 7..63 CDD:459954 37/55 (67%)
AT3G09500NP_187561.1 Ribosomal_L29 8..60 CDD:459954 36/51 (71%)

Return to query results.
Submit another query.