DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL35 and AT2G39390

DIOPT Version :9

Sequence 1:NP_001284900.1 Gene:RpL35 / 31483 FlyBaseID:FBgn0029785 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_181471.1 Gene:AT2G39390 / 818524 AraportID:AT2G39390 Length:123 Species:Arabidopsis thaliana


Alignment Length:122 Identity:72/122 - (59%)
Similarity:90/122 - (73%) Gaps:0/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVVRKAIARVYIVMHQKQ 65
            |.::|..|||.|.|.:|:.||.|.|.||..|||||||||||:|||||:||||:||:|..|:.|||
plant     1 MARIKVHELREKSKADLSGQLKEFKAELALLRVAKVTGGAPNKLSKIKVVRKSIAQVLTVISQKQ 65

  Fly    66 KENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDANRKTLKEIRKRSVFPQRKFAVK 122
            |..||:.:||||..|||||.|||||||:.|:...|:.||.:|.:|...||.||:|:|
plant    66 KSALREAYKNKKLLPLDLRPKKTRAIRRRLTKHQASLKTEREKKKEMYFPIRKYAIK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL35NP_001284900.1 Ribosomal_L29 7..64 CDD:279204 36/56 (64%)
AT2G39390NP_181471.1 Ribosomal_L29 8..63 CDD:395669 36/54 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 74 1.000 Domainoid score I3226
eggNOG 1 0.900 - - E1_COG0255
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31432
Inparanoid 1 1.050 138 1.000 Inparanoid score I1807
OMA 1 1.010 - - QHG53927
OrthoDB 1 1.010 - - D1468839at2759
OrthoFinder 1 1.000 - - FOG0001124
OrthoInspector 1 1.000 - - otm2768
orthoMCL 1 0.900 - - OOG6_100532
Panther 1 1.100 - - O PTHR45722
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.