powered by:
Protein Alignment RpL35 and Stt3B
DIOPT Version :9
Sequence 1: | NP_001284900.1 |
Gene: | RpL35 / 31483 |
FlyBaseID: | FBgn0029785 |
Length: | 123 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_524494.1 |
Gene: | Stt3B / 43005 |
FlyBaseID: | FBgn0011336 |
Length: | 774 |
Species: | Drosophila melanogaster |
Alignment Length: | 59 |
Identity: | 14/59 - (23%) |
Similarity: | 27/59 - (45%) |
Gaps: | 7/59 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 LRKVFKNKKYKPLDLRKKKTRAIRKALSPRD-ANRKTLKE----IRKRSVFPQRKFAVK 122
|.::::.| ||.:..:...:...:.:.|.: .:||..|. ||.|.|..:.|..:|
Fly 718 LVRIYRVK--KPHEFNRPSLKTKERTIPPANFISRKNSKRRKGYIRNRPVVVKGKRTLK 774
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45447382 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.