DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL35 and rpl35

DIOPT Version :9

Sequence 1:NP_001284900.1 Gene:RpL35 / 31483 FlyBaseID:FBgn0029785 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_988916.1 Gene:rpl35 / 394512 XenbaseID:XB-GENE-969827 Length:123 Species:Xenopus tropicalis


Alignment Length:123 Identity:80/123 - (65%)
Similarity:95/123 - (77%) Gaps:0/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVVRKAIARVYIVMHQKQ 65
            |.|:|..:||.|.|:||.||||:||.||..||||||||||.|||||||||||:||||..|::|.|
 Frog     1 MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQ 65

  Fly    66 KENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDANRKTLKEIRKRSVFPQRKFAVKA 123
            ||||||.:|.|||||||||.|||||:|:.|:..:...:|.|:.||..:|..|||||||
 Frog    66 KENLRKFYKGKKYKPLDLRPKKTRALRRRLNKHEEGLRTKKQQRKDRLFSARKFAVKA 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL35NP_001284900.1 Ribosomal_L29 7..64 CDD:279204 40/56 (71%)
rpl35NP_988916.1 Ribosomal_L29 8..63 CDD:307121 40/54 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I8899
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31432
Inparanoid 1 1.050 149 1.000 Inparanoid score I4290
OMA 1 1.010 - - QHG53927
OrthoDB 1 1.010 - - D1468839at2759
OrthoFinder 1 1.000 - - FOG0001124
OrthoInspector 1 1.000 - - otm48185
Panther 1 1.100 - - LDO PTHR45722
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1132
SonicParanoid 1 1.000 - - X1108
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.