DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL35 and Rpl35

DIOPT Version :10

Sequence 1:NP_572243.1 Gene:RpL35 / 31483 FlyBaseID:FBgn0029785 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_063139598.1 Gene:Rpl35 / 296709 RGDID:1303007 Length:126 Species:Rattus norvegicus


Alignment Length:74 Identity:52/74 - (70%)
Similarity:60/74 - (81%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVVRKAIARVYIVMHQKQ 65
            |.|:|..:||.|.|:||.||||:||.||..||||||||||.|||||||||||:||||..|::|.|
  Rat     1 MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQ 65

  Fly    66 KENLRKVFK 74
            ||||||.:|
  Rat    66 KENLRKFYK 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL35NP_572243.1 Ribosomal_L29 7..63 CDD:459954 40/55 (73%)
Rpl35XP_063139598.1 None

Return to query results.
Submit another query.