DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL35 and rpl35

DIOPT Version :9

Sequence 1:NP_001284900.1 Gene:RpL35 / 31483 FlyBaseID:FBgn0029785 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_587693.1 Gene:rpl35 / 2539308 PomBaseID:SPCC613.05c Length:122 Species:Schizosaccharomyces pombe


Alignment Length:120 Identity:65/120 - (54%)
Similarity:90/120 - (75%) Gaps:0/120 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVVRKAIARVYIVMHQKQKEN 68
            :|..|||.:.::.|.:||.||:.||.||||.|:.||:.||||||:..||.|||:..|:::..:..
pombe     3 LKTFELRKQSQENLAEQLQELRQELASLRVQKIAGGSGSKLSKIKTTRKDIARILTVINESNRLA 67

  Fly    69 LRKVFKNKKYKPLDLRKKKTRAIRKALSPRDANRKTLKEIRKRSVFPQRKFAVKA 123
            .|:.:|||||.|||||:|||||||:||:|.:.:|||||:|:|...||.||:|:||
pombe    68 AREAYKNKKYIPLDLRQKKTRAIRRALTPYEQSRKTLKQIKKERYFPLRKYALKA 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL35NP_001284900.1 Ribosomal_L29 7..64 CDD:279204 29/56 (52%)
rpl35NP_587693.1 RpmC 1..70 CDD:223333 30/66 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I2463
eggNOG 1 0.900 - - E1_COG0255
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31432
Inparanoid 1 1.050 129 1.000 Inparanoid score I1435
OMA 1 1.010 - - QHG53927
OrthoFinder 1 1.000 - - FOG0001124
OrthoInspector 1 1.000 - - oto100985
orthoMCL 1 0.900 - - OOG6_100532
Panther 1 1.100 - - LDO PTHR45722
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1132
SonicParanoid 1 1.000 - - X1108
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.