DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL35 and rpl-35

DIOPT Version :9

Sequence 1:NP_001284900.1 Gene:RpL35 / 31483 FlyBaseID:FBgn0029785 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001379601.1 Gene:rpl-35 / 176097 WormBaseID:WBGene00004449 Length:123 Species:Caenorhabditis elegans


Alignment Length:123 Identity:69/123 - (56%)
Similarity:88/123 - (71%) Gaps:0/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVVRKAIARVYIVMHQKQ 65
            |.|:||..||.:.|..|.|:|||.|.||.:|||:||||||.|||||||||||.|||:..|::|.|
 Worm     1 MTKLKCKSLRGEKKDALQKKLDEQKTELATLRVSKVTGGAASKLSKIRVVRKNIARLLTVINQTQ 65

  Fly    66 KENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDANRKTLKEIRKRSVFPQRKFAVKA 123
            |:.|||.:.:.||||:|||.|||||||:.|:..:.:.::.|:..|......|||||||
 Worm    66 KQELRKFYADHKYKPIDLRLKKTRAIRRRLTAHELSLRSAKQQAKSRNQAVRKFAVKA 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL35NP_001284900.1 Ribosomal_L29 7..64 CDD:279204 35/56 (63%)
rpl-35NP_001379601.1 Ribosomal_L29 7..63 CDD:395669 35/55 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167002
Domainoid 1 1.000 65 1.000 Domainoid score I6634
eggNOG 1 0.900 - - E1_COG0255
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31432
Inparanoid 1 1.050 127 1.000 Inparanoid score I3257
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53927
OrthoDB 1 1.010 - - D1468839at2759
OrthoFinder 1 1.000 - - FOG0001124
OrthoInspector 1 1.000 - - oto20755
orthoMCL 1 0.900 - - OOG6_100532
Panther 1 1.100 - - LDO PTHR45722
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1132
SonicParanoid 1 1.000 - - X1108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.