DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL35 and RPL35

DIOPT Version :10

Sequence 1:NP_572243.1 Gene:RpL35 / 31483 FlyBaseID:FBgn0029785 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_009140.1 Gene:RPL35 / 11224 HGNCID:10344 Length:123 Species:Homo sapiens


Alignment Length:123 Identity:81/123 - (65%)
Similarity:97/123 - (78%) Gaps:0/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVVRKAIARVYIVMHQKQ 65
            |.|:|..:||.|.|:||.||||:||.||..||||||||||.|||||||||||:||||..|::|.|
Human     1 MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQ 65

  Fly    66 KENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDANRKTLKEIRKRSVFPQRKFAVKA 123
            ||||||.:|.|||||||||.|||||:|:.|:..:.|.||.|:.||..::|.||:||||
Human    66 KENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEENLKTKKQQRKERLYPLRKYAVKA 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL35NP_572243.1 Ribosomal_L29 7..63 CDD:459954 40/55 (73%)
RPL35NP_009140.1 Ribosomal_L29 8..63 CDD:459954 40/54 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..123 18/36 (50%)

Return to query results.
Submit another query.