DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4119 and SNU71

DIOPT Version :9

Sequence 1:NP_001284899.1 Gene:CG4119 / 31481 FlyBaseID:FBgn0028474 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_011527.1 Gene:SNU71 / 852896 SGDID:S000003245 Length:620 Species:Saccharomyces cerevisiae


Alignment Length:549 Identity:106/549 - (19%)
Similarity:192/549 - (34%) Gaps:184/549 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VSTFGFCEFDGPIAAMRAVRLLSEMEIDGKKLVAKVDAKNKVLIEDYKEQECKNGDRSNPVDEKT 157
            |:|..:|:     |....:|.|.|    ..|:...:|...|..:||      :.|...:...||.
Yeast   183 VNTLNYCK-----ALFAFIRKLHE----DFKIELHLDLNTKEYVED------RTGTIPSVKPEKA 232

  Fly   158 EDEFAIAQMHEFLEEHKHEFEGFDSSSRADLYGSANRNKKTRREEDIKMKV-LSENTLEE---EK 218
            .:.:::   .:.:|:...|                 ||.|..:.:|...:. :..|||.:   :.
Yeast   233 SEFYSV---FKNIEDQTDE-----------------RNSKKEQLDDSSTQYKVDTNTLSDLPSDA 277

  Fly   219 RNLISSEIGKFRMRAEEDEHRKELEKEKEKEKLAASKEKERKKQREMERMSSTSKSGSSSTAAAS 283
            .:.:..:|.:||.:.      ..:||||   |:.::.|:.|:::.:|:::....:...|      
Yeast   278 LDQLCKDIIEFRTKV------VSIEKEK---KMKSTYEESRRQRHQMQKVFDQIRKNHS------ 327

  Fly   284 SSSATATSSTPAADGADMSDKTDKESVAVVIKETVKESKESASSTGRKESSSAAIEITQKERRSD 348
                          ||..|..|::|       :|..|.::....|    ....|:|..::||  |
Yeast   328 --------------GAKGSANTEEE-------DTNMEDEDEEDDT----EDDLALEKRKEER--D 365

  Fly   349 SKETRRR------RSKSRSKDRERERERELRELRDKERERERDRE---RERERERNEM---RERE 401
            .:|:.||      :..|.::.:.:....::....:.|...|::|.   :|.....|::   ..|.
Yeast   366 LEESNRRYEDMLHQLHSNTEPKIKSIRADIMSAENYEEHLEKNRSLYLKELLHLANDVHYDHHRS 430

  Fly   402 RNEMREREREREREREREEKLLKPVRDTWREKEMEDELRDRK-----------------KAEKKA 449
            ..|..||..|.:|.:....|.|.|:           :|.|.|                 |:|...
Yeast   431 FKEQEERRDEEDRAKNGNAKELAPI-----------QLSDGKAISAGKAAAITLPEGTVKSENYN 484

  Fly   450 REKEIAYQT----------RLTDWEVREKRKAKENEKYRLKELLRQEERETDAKRLKEFVEDYDD 504
            .:|.::..:          :..|..|   ..:.|:|.||..||...:..|..|            
Yeast   485 ADKNVSESSEHVKIKFDFKKAIDHSV---ESSSEDEGYRESELPPTKPSERSA------------ 534

  Fly   505 ERDDSLYYRGRELQQRLAERVREADADSKDREKEAEELAELKSKFFSGEYENPSLEFEKARLEIE 569
             .:|.|.:...||..||...            ||:..:.||..:|. |.||:..:|:        
Yeast   535 -AEDRLPFTADELNIRLTNL------------KESRYVDELVREFL-GVYEDELVEY-------- 577

  Fly   570 KLYEPRILINVNQEPPAAATSSVHQRKQA 598
                  ||.|:.          |:|.|||
Yeast   578 ------ILENIR----------VNQSKQA 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4119NP_001284899.1 RRM_RBM25 62..136 CDD:240892 10/42 (24%)
PWI 917..988 CDD:214609
SNU71NP_011527.1 PWI 547..620 CDD:214609 19/81 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2253
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.