DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4119 and H28G03.2

DIOPT Version :9

Sequence 1:NP_001284899.1 Gene:CG4119 / 31481 FlyBaseID:FBgn0028474 Length:998 Species:Drosophila melanogaster
Sequence 2:NP_741780.1 Gene:H28G03.2 / 180790 WormBaseID:WBGene00019250 Length:548 Species:Caenorhabditis elegans


Alignment Length:329 Identity:58/329 - (17%)
Similarity:120/329 - (36%) Gaps:86/329 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 LEEEKRNLISSEIGKFRMRA-----EEDEHRKE---LEKEKEKEKLAASKEKERKKQREMERMSS 270
            :|....:|...|||:....|     ::.|:..|   ||:::.:|.:.|:.:::.....|..|..:
 Worm    15 VENPDIDLQDGEIGEESFEATQAYLQDMENSAEAIALERQRAEEAVMATMDEDDDGLNEFGRPRN 79

  Fly   271 TSKSGSSSTAAASSSSATATSSTPAADGA--------------DMSD------------KTDKES 309
            ..:                |...||.:|.              |:||            ||..|.
 Worm    80 PPR----------------TPPEPAPEGQPTCESIGFVNEEFDDVSDDGEIPGRKRIGPKTPPEE 128

  Fly   310 VAVVIKETVKESKESASSTGRKESSSAAIEITQKERRSDSKETRRRR----------------SK 358
            ..  ..:.:::::|..|...........|.|.:.:...:||..:|.|                |:
 Worm   129 PE--SPKQIEQTREQGSDGELTGDDMEPIPIIEPKLNKESKREKRPRTPPLRARQFSCPQSPTSR 191

  Fly   359 SRSKDRERERERELRELRDKERERERDRERERERERNEMRERERNEMRERER--------ERERE 415
            .|:......|....||:..::|   |..:::|...|.|:.:.....:...::        |:...
 Worm   192 HRNSSFSPPRRHATREVHSRKR---RHDDKKRSTVRPEVSKELTFPVVATQKCLSLLEFVEKRGL 253

  Fly   416 REREEKLLKPVRDTWREKEMEDELRDRKKAEKKAREKEIAYQTRLTDWEVREKRKAKENEKYRLK 480
            ...:::||:.|||:....:...::..:|:|.||..|...|       ||:.:.::...|....::
 Worm   254 TITDDELLQVVRDSIELDQAMGKIVKKKEAMKKQMEDMAA-------WELEKIKRIHANMPRHMQ 311

  Fly   481 ELLR 484
            ::|:
 Worm   312 DVLK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4119NP_001284899.1 RRM_RBM25 62..136 CDD:240892
PWI 917..988 CDD:214609
H28G03.2NP_741780.1 Mif2_N <126..233 CDD:292257 19/111 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.