DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and HST2

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_015310.1 Gene:HST2 / 856092 SGDID:S000005936 Length:357 Species:Saccharomyces cerevisiae


Alignment Length:284 Identity:77/284 - (27%)
Similarity:129/284 - (45%) Gaps:65/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EDDIKRLEDFLLSKPN--VLVLTGAGISTESGIPDYRSEGVGLY---ARSN---HKPVQHMEFVK 88
            |..::::...:.|.||  |:.:.||||||..||||:||.|.|||   ||..   .:.|..::|.:
Yeast     9 EMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQ 73

  Fly    89 SS-----AVRKRYWARNFVGWPKFSATQPNATHHALARFEREERVQAVVTQNVDRLHTKAGSRN- 147
            |.     .:.|..:..||         :|:..|:.|..|:.::.::.|.|||:|.|..:||.:: 
Yeast    74 SDPLPFYTLAKELYPGNF---------RPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDD 129

  Fly   148 -VVEVHGSGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPLEYIENFRIPEC 211
             ::|.|||.....|:.|........|:|.||                   |.|   |::|  .:|
Yeast   130 LIIEAHGSFAHCHCIGCGKVYPPQVFKSKLA-------------------EHP---IKDF--VKC 170

  Fly   212 TQCGGDLKPEIVFFGDSVP--------------RPRVDQIAGMVYNSDGLLVLGSSLLV--FSGY 260
            ..||..:||.|||||:.:|              |.:: ..:|.......::|:|:||.|  |:..
Yeast   171 DVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKI-TTSGKHPQQPLVIVVGTSLAVYPFASL 234

  Fly   261 RVVLQTKDLKLPVGIVNIGETRAD 284
            ...:..|..::...:..:|:.:|:
Yeast   235 PEEIPRKVKRVLCNLETVGDFKAN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 76/278 (27%)
HST2NP_015310.1 SIRT1 26..277 CDD:238699 73/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.