DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and HST3

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_014668.1 Gene:HST3 / 854190 SGDID:S000005551 Length:447 Species:Saccharomyces cerevisiae


Alignment Length:371 Identity:91/371 - (24%)
Similarity:145/371 - (39%) Gaps:111/371 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RSTSLRS---STARQEYVPHHKPVVEDD--IKRLEDFLLSKPNVLVLTGAGISTESGIPDYRSEG 69
            ||.|:.|   |:.:.|.:.|...:..||  ::|:...|.....:..|||||||..:||||:||..
Yeast    12 RSGSMCSDLPSSLQTEKLAHIIGLDADDEVLRRVTKQLSRSRRIACLTGAGISCNAGIPDFRSSD 76

  Fly    70 VGLYARSNHKPVQHMEFVKSSAVRKRYWA----RNFVG------------WPKF--------SAT 110
             |||           :.||...  .:||:    |....            :.||        ...
Yeast    77 -GLY-----------DLVKKDC--SQYWSIKSGREMFDISLFRDDFKISIFAKFMERLYSNVQLA 127

  Fly   111 QPNATHHALARFEREERVQAVVTQNVDRLHTKAG------------------SRNVVEVHGSGYV 157
            :|..||..:|..:...::....|||:|.|....|                  :.:||::||....
Yeast   128 KPTKTHKFIAHLKDRNKLLRCYTQNIDGLEESIGLTLSNRKLPLTSFSSHWKNLDVVQLHGDLKT 192

  Fly   158 VKCLSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPL----EYIENFRIPECTQCGGD- 217
            :.|..|        ||:.     |..:.....:|..   |:||    |.:.|.|:.|..:..|. 
Yeast   193 LSCTKC--------FQTF-----PWSRYWSRCLRRG---ELPLCPDCEALINKRLNEGKRTLGSN 241

  Fly   218 ---LKPEIVFFGDSVPRPRV-------DQIAGMVYNSDGLLVLGSSLLVFSGYRVVLQTKDLKLP 272
               |:|.||.:|::.|...:       |.|.|   |.|.|:::|:||.| .|.:.:::....|:.
Yeast   242 VGILRPNIVLYGENHPSCEIITQGLNLDIIKG---NPDFLIIMGTSLKV-DGVKQLVKKLSKKIH 302

  Fly   273 -----VGIVN---IGETRADHLADIKISAKCGD-------VIPKLF 303
                 :.:||   |||:....:.|.:|.:.|.:       .||..|
Yeast   303 DRGGLIILVNKTPIGESSWHGIIDYQIHSDCDNWVTFLESQIPDFF 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 78/332 (23%)
HST3NP_014668.1 SIR2 42..349 CDD:223915 82/341 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.