DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and HST4

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_010477.3 Gene:HST4 / 851772 SGDID:S000002599 Length:370 Species:Saccharomyces cerevisiae


Alignment Length:353 Identity:84/353 - (23%)
Similarity:129/353 - (36%) Gaps:106/353 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QLLRFRSTSLRSSTARQEYVP----------------------HHKPVVEDDIKRLEDFLLSKPN 47
            :||.....|:|:...|..|.|                      ||   ::.|...:...|.....
Yeast    33 RLLPQLKKSVRNRKPRLSYRPELNSVFDLDAYVDSTHLSKSQRHH---MDRDAGFISYALNYSKR 94

  Fly    48 VLVLTGAGISTESGIPDYRSEGVGLYARSN---HKPVQHMEFVKSSAVRKRYWARNFVGWPKFSA 109
            ::|::|||||..:||||:|| ..|:::..|   .|.:.....|.........:.:..|...:.|.
Yeast    95 MVVVSGAGISVAAGIPDFRS-SEGIFSTVNGGSGKDLFDYNRVYGDESMSLKFNQLMVSLFRLSK 158

  Fly   110 T-QPNATHHALARFEREERVQAVVTQNVDRLHTKAG--SRNV---------VEVHGSGYVVKCLS 162
            . ||...|..|..|.|:.|:..:.|||:|.|.|:..  |.||         |::|||   :|.:.
Yeast   159 NCQPTKFHEMLNEFARDGRLLRLYTQNIDGLDTQLPHLSTNVPLAKPIPSTVQLHGS---IKHME 220

  Fly   163 CEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPLEYIENFRIPECTQCG------------ 215
            |...::...|...|...:..|         |...||         ||.|.||.            
Yeast   221 CNKCLNIKPFDPELFKCDDKF---------DSRTEI---------IPSCPQCEEYETVRKMAGLR 267

  Fly   216 ----GDLKPEIVFFGDSVPRPRVDQIAGMVYNS-----DGLLVLGSSLLVFSGYRVVLQTKDLKL 271
                |.|:|.::.:.:  ..|..|.|..:..|.     |.|:::|:|               ||:
Yeast   268 STGVGKLRPRVILYNE--VHPEGDFIGEIANNDLKKRIDCLIIVGTS---------------LKI 315

  Fly   272 PVGIVNIGETRADHLADIKISAKCGDVI 299
            | |:.||....|     .|:.|..|.|:
Yeast   316 P-GVKNICRQFA-----AKVHANRGIVL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 73/296 (25%)
HST4NP_010477.3 SIR2 77..370 CDD:223915 76/309 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.