DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and SIR2

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_010242.1 Gene:SIR2 / 851520 SGDID:S000002200 Length:562 Species:Saccharomyces cerevisiae


Alignment Length:328 Identity:84/328 - (25%)
Similarity:129/328 - (39%) Gaps:83/328 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RLEDF---------LLSKPNVLVLTGAGISTESGIPDYRSEGVGLYARSNHKPVQHME------- 85
            ||.:|         |.:...:|||||||:||..||||:|| ..|.|::..|..:...:       
Yeast   237 RLSNFFTIDHFIQKLHTARKILVLTGAGVSTSLGIPDFRS-SEGFYSKIKHLGLDDPQDVFNYNI 300

  Fly    86 FVKSSAVRKRYWARNFVGWPKFSATQPNATHHALARFEREERVQAVVTQNVDRLHTKAG--SRNV 148
            |:...:|  .|...|.| .|......|  .|..:...:.:.::....|||:|.|.:.||  :..:
Yeast   301 FMHDPSV--FYNIANMV-LPPEKIYSP--LHSFIKMLQMKGKLLRNYTQNIDNLESYAGISTDKL 360

  Fly   149 VEVHGSGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPL---------EYI- 203
            |:.|||.....|::|.:.:......:.:.:|                 |:||         ||. 
Yeast   361 VQCHGSFATATCVTCHWNLPGERIFNKIRNL-----------------ELPLCPYCYKKRREYFP 408

  Fly   204 ENF---------------RIPECTQCGGDLKPEIVFFGDSVPRPRVDQIAGMVYNSDGLLVLGSS 253
            |.:               |.|......|.|||:|.|||:::|......|...:...|.|:.:|:|
Yeast   409 EGYNNKVGVAASQGSMSERPPYILNSYGVLKPDITFFGEALPNKFHKSIREDILECDLLICIGTS 473

  Fly   254 L----------LVFSGYRVVLQTKDLKLPVGIVNIGETRADHLADI--KISAKCGDVIP--KLFD 304
            |          :|.|....||..:|   ||.......:...:..||  .::.|||..||  |..|
Yeast   474 LKVAPVSEIVNMVPSHVPQVLINRD---PVKHAEFDLSLLGYCDDIAAMVAQKCGWTIPHKKWND 535

  Fly   305 FRN 307
            .:|
Yeast   536 LKN 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 78/315 (25%)
SIR2NP_010242.1 DUF592 104..261 CDD:368003 6/23 (26%)
SIRT1 255..517 CDD:238699 71/287 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.