DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and sirt1

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_001334440.4 Gene:sirt1 / 797132 ZFINID:ZDB-GENE-070801-2 Length:710 Species:Danio rerio


Alignment Length:311 Identity:89/311 - (28%)
Similarity:138/311 - (44%) Gaps:73/311 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DIKRLED---FLLSKPNVLVLTGAGISTESGIPDYRSEGVGLYARSNHKPVQHMEFVKSSAVRK- 94
            ||..|||   .|..:..:|||||||:|...||||:||.. |:|||   ..|...:.....|:.. 
Zfish   175 DINTLEDVVRLLNERKKILVLTGAGVSVSCGIPDFRSRD-GIYAR---LAVDFPDLPDPQAMFDI 235

  Fly    95 RYWARNFVGWPKFSAT------QPNATHHALARFEREERVQAVVTQNVDRLHTKAGSRNVVEVHG 153
            .|:.|:...:.||:..      ||:..|..::..:::.|:....|||:|.|...||.:.:::.||
Zfish   236 DYFRRDPRPFFKFAKEIYPGQFQPSPCHRFISMLDKKGRLLRNYTQNIDTLEQVAGIQKIIQCHG 300

  Fly   154 SGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPLEYIENFRIPECTQCGGD- 217
            |.....||.|::::|                  .:.||.|         |.|..:|.|.:|..| 
Zfish   301 SFATASCLICKHKVD------------------CEAIRED---------IFNQVVPHCPRCPSDV 338

  Fly   218 ----LKPEIVFFGDSVP-------RPRVDQIAGMVYNSDGLLVLGSSLLVFSGYRVVLQTKDLKL 271
                :||:|||||:::|       :...|::       |.|:|:||||.|   ..|.|....:..
Zfish   339 PYAIMKPDIVFFGENLPEFFHRAMKQDKDEV-------DLLIVIGSSLKV---RPVALIPSSIPH 393

  Fly   272 PVGIVNIGETRADHL-ADIKISAKCGDVIPKLF-----DFR----NSKSVS 312
            .|..|.|......|| .|:::...|..::.:|.     ||:    ||..:|
Zfish   394 DVPQVLINREPLPHLNFDVELLGDCDVIVNELCHRLNGDFQQLCYNSSRLS 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 81/283 (29%)
sirt1XP_001334440.4 SIRT1 190..425 CDD:238699 77/275 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.