DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and Sirt3

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001171275.1 Gene:Sirt3 / 64384 MGIID:1927665 Length:334 Species:Mus musculus


Alignment Length:277 Identity:76/277 - (27%)
Similarity:117/277 - (42%) Gaps:74/277 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VLVLTGAGISTESGIPDYRSEGVGLYARSNHKPVQHMEFVKSSA-----------VRKRYWARNF 101
            |:|:.||||||.|||||:||.|.|||:......:.:.|.:....           :.|..:..::
Mouse    75 VVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFHNPKPFFMLAKELYPGHY 139

  Fly   102 VGWPKFSATQPNATHHALARFEREERVQAVVTQNVDRLHTKAG--SRNVVEVHGSGYVVKCLSCE 164
                     :||.||:.|.....:|.:..:.|||:|.|...:|  :..:||.||:.....|..| 
Mouse   140 ---------RPNVTHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVEAHGTFVTATCTVC- 194

  Fly   165 YRIDRHEFQSILASLNPAFKDAPDMIRPDGDV--EIPLEYIENFRIPECTQCGGDLKPEIVFFGD 227
                |..|                   |..|:  ::..:     |:|.|..|.|.:||:|||||:
Mouse   195 ----RRSF-------------------PGEDIWADVMAD-----RVPRCPVCTGVVKPDIVFFGE 231

  Fly   228 SVPRPRVDQIAGMVYNSDGLLVLGSSLLV--FSGYRVVLQ--------TKDLKLPVGIVNIGETR 282
            .:|...:..:|.... :|.||:||:||.|  |:.....:|        .:||   ||...:...|
Mouse   232 QLPARFLLHMADFAL-ADLLLILGTSLEVEPFASLSEAVQKSVPRLLINRDL---VGPFVLSPRR 292

  Fly   283 ADHLADIKISAKCGDVI 299
            .|       ..:.|||:
Mouse   293 KD-------VVQLGDVV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 75/275 (27%)
Sirt3NP_001171275.1 SIRT1 74..308 CDD:238699 76/277 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.