DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and sirt3

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_009301762.1 Gene:sirt3 / 558775 ZFINID:ZDB-GENE-070112-1762 Length:358 Species:Danio rerio


Alignment Length:296 Identity:78/296 - (26%)
Similarity:128/296 - (43%) Gaps:71/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HKPVVEDDIKRLEDFLLSKPNVLVLTGAGISTESGIPDYRSEGVGLYARSNHKPVQHMEFV---- 87
            |:..:||..:::.:....:  ::|:.||||||.|||||:||.|.|||.......:.:.|.:    
Zfish    84 HQQTLEDIAEKIRERKFKR--IVVMAGAGISTPSGIPDFRSPGSGLYDNLQQYNLPYAEAIFEIN 146

  Fly    88 -------KSSAVRKRYWARNFVGWPKFSATQPNATHHALARFEREERVQAVVTQNVDRLHTKAG- 144
                   ...|:.|..:..|:         |||.||:.:.....:|::..:.|||:|.|...|| 
Zfish   147 YFHHNPNPFFALAKELYPGNY---------QPNLTHYFIRMLHDKEQLLRMYTQNIDGLERMAGI 202

  Fly   145 -SRNVVEVHGSGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPLEYIENFRI 208
             .:.:||.||:.....|..|     |.:::.             :.:|.|         |....:
Zfish   203 PPKMLVEAHGTFATATCTVC-----RRDYKG-------------EELRDD---------IMAGTV 240

  Fly   209 PECTQCGGDLKPEIVFFGDSVPRPRVDQIAGMVYNSDGLLVLGSSL----------LVFSGYRVV 263
            |:|..|.|.:||:|||||:.:|:.....:..... :|.|:|:|:||          .|......:
Zfish   241 PKCPTCKGIIKPDIVFFGEELPQHFFTYLTDFPI-ADLLIVMGTSLEVEPFASLAGAVRGSVPRL 304

  Fly   264 LQTKDLKLPVGIVNIGETRADHLADIKISAKCGDVI 299
            |..:||   ||....|..|...:|::      |||:
Zfish   305 LINRDL---VGPFASGSQRHTDVAEL------GDVV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 74/283 (26%)
sirt3XP_009301762.1 SIRT1 101..337 CDD:238699 75/279 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.