DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and Sirt7

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster


Alignment Length:344 Identity:92/344 - (26%)
Similarity:139/344 - (40%) Gaps:95/344 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RVGQLLRFRSTSLRSSTARQ-----------------------------EYVPHHKPVVEDDIKR 37
            ||..:|| :..|:|::..||                             |..||   |:|..:::
  Fly    55 RVSMILR-KCDSMRTTEDRQFLEKHPDMVKTTKKRKERVEIYKERVVEREDAPH---VIEAKVEQ 115

  Fly    38 LEDFLLSKPNVLVLTGAGISTESGIPDYR-SEGVGLYARSNHKPVQHMEFVKSSAVRKRYWARNF 101
            |.:.:....:::..|||||||.:.||||| |:|:....:....                      
  Fly   116 LANIISQAKHLVCYTGAGISTAALIPDYRGSQGIWTLLQKGQD---------------------- 158

  Fly   102 VGWPKFSATQPNATHHALARFEREERVQAVVTQNVDRLHTKAG-SRN-VVEVHGSGYVVKCLSCE 164
            :|....|:..|..||.||....|...:..||:||.|.||.::| .|| :.|:||:.||..|.:|.
  Fly   159 IGEHDLSSANPTYTHMALYELHRRRLLHHVVSQNCDGLHLRSGLPRNSLSEIHGNMYVEVCKNCR 223

  Fly   165 YRIDRHEFQSILASLNPAFKDAPDMI--RPDGDVEIPLEYI-ENFRIPECTQCGGDLKPEIVFFG 226
                                  |:.:  |.....|:...|. :..|:  |.:|...|...||.||
  Fly   224 ----------------------PNSVYWRQFDTTEMTARYCHKTHRL--CHRCSEPLYDTIVHFG 264

  Fly   227 D--SVPRPRVDQIAGMVYN---SDGLLVLGSSLLVFSGYRVVLQ---TKDLKLPVGIVNIGETRA 283
            :  :|..|.  ..||...|   :|.:|.|||||.|...|..:.|   ....:..:.:||:..|..
  Fly   265 ERGNVKWPL--NWAGATANAQRADVILCLGSSLKVLKKYTWLWQMDRPARQRAKICVVNLQWTPK 327

  Fly   284 DHLADIKISAKCGDVIPKL 302
            |.:|.|||:.||..|:.:|
  Fly   328 DAIASIKINGKCDQVMAQL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 77/274 (28%)
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 74/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438945
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48252
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.