DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and Sirt6

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_649990.2 Gene:Sirt6 / 41254 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster


Alignment Length:293 Identity:79/293 - (26%)
Similarity:125/293 - (42%) Gaps:75/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VVEDDIKRLEDFLLSKPNVLVLTGAGISTESGIPDYRS-EGVGLYARSNHKPVQHMEFVKSSAVR 93
            ||.:..:.|.:.:....:|::.|||||||.:||||:|. :||........||    :|..|    
  Fly    29 VVAEKCQELAELIKKSGHVVLHTGAGISTSAGIPDFRGPKGVWTLEEKGEKP----DFNVS---- 85

  Fly    94 KRYWARNFVGWPKFSATQPNATHHALARFEREERVQAVVTQNVDRLHTKAG--SRNVVEVHGSGY 156
                         |...:|..||.|:........||.|::||:|.||.|:|  .:.:.|:||:.|
  Fly    86 -------------FDEARPTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYLSELHGNIY 137

  Fly   157 VVKCLSCEYRIDRHEFQSILA-------SLNPAFKDAPDMIRPDGDVEIPLEYIENFRIPECTQC 214
            :.:|..|     |.:|.|..|       ||..|.|.:.|                        ..
  Fly   138 IEQCKKC-----RRQFVSPSAVETVGQKSLQRACKSSMD------------------------SK 173

  Fly   215 GGDLKPEIVFFGDSV-----PRPRVDQIAGMVYN--SDGLLVLGSSL-LVFSGYRVVLQTKDLKL 271
            |...:..|::  |:|     ..|..|...|::::  :|..:.||::| :|.||   .|..|:||.
  Fly   174 GRSCRSGILY--DNVLDWEHDLPENDLEMGVMHSTVADLNIALGTTLQIVPSG---DLPLKNLKC 233

  Fly   272 --PVGIVNIGETRADHLADIKISAKCGDVIPKL 302
              ...|.|:..|:.|..|::.||:....|:.|:
  Fly   234 GGKFVICNLQPTKHDKKANLIISSYVDVVLSKV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 75/280 (27%)
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 74/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438948
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48252
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.