DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and Sirt1

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_477351.1 Gene:Sirt1 / 34708 FlyBaseID:FBgn0024291 Length:823 Species:Drosophila melanogaster


Alignment Length:279 Identity:77/279 - (27%)
Similarity:111/279 - (39%) Gaps:80/279 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EYVPH--HKPVVEDDIKRLEDF-----LLSK-PNVLVLTGAGISTESGIPDYRSEGVGLYARSNH 78
            :|:.|  ::|...:.:..:..|     |:.| ..::||||||:|...||||:||.. |:|||..|
  Fly   190 DYLAHLLNEPKRRNKLASVNTFDDVISLVKKSQKIIVLTGAGVSVSCGIPDFRSTN-GIYARLAH 253

  Fly    79 ------KPVQHMEFVKSSAVRKRYWARNFVGWPKFSAT------QPNATHHALARFEREERVQAV 131
                  .|....:.        .|:.|:...:.||:..      ||:..|..:...|.:.::...
  Fly   254 DFPDLPDPQAMFDI--------NYFKRDPRPFYKFAREIYPGEFQPSPCHRFIKMLETKGKLLRN 310

  Fly   132 VTQNVDRLHTKAGSRNVVEVHGSGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDV 196
            .|||:|.|...||.:.|:|.|||.....|..|.                  ||...|.:|.|   
  Fly   311 YTQNIDTLERVAGIQRVIECHGSFSTASCTKCR------------------FKCNADALRAD--- 354

  Fly   197 EIPLEYIENFRIPECTQC------------------------GGDLKPEIVFFGDSVPRPRVDQI 237
                  |...|||.|.||                        .|.:||:|||||:.:|......:
  Fly   355 ------IFAQRIPVCPQCQPNKEQSVDASVAVTEEELRQLVENGIMKPDIVFFGEGLPDEYHTVM 413

  Fly   238 AGMVYNSDGLLVLGSSLLV 256
            |......|.|:|:||||.|
  Fly   414 ATDKDVCDLLIVIGSSLKV 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 74/261 (28%)
Sirt1NP_477351.1 DUF592 <202..228 CDD:282439 4/25 (16%)
SIRT1 222..476 CDD:238699 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438949
Domainoid 1 1.000 54 1.000 Domainoid score I647
eggNOG 1 0.900 - - E1_COG0846
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51312
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48252
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.