DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and sirt2

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_955890.1 Gene:sirt2 / 322309 ZFINID:ZDB-GENE-030131-1028 Length:379 Species:Danio rerio


Alignment Length:276 Identity:69/276 - (25%)
Similarity:123/276 - (44%) Gaps:58/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PHHKPVVEDDIKRLEDFLLSK--PNVLVLTGAGISTESGIPDYRSEGVGLYARSNH------KPV 81
            |..|.:.|..:..:..::||.  .|::.:.||||||.:||||:||.|.||||....      :.:
Zfish    52 PGDKVLDELTLDSVARYILSGKCKNIICMVGAGISTSAGIPDFRSPGTGLYANLQKYNLPYPEAI 116

  Fly    82 QHMEFVKSS-----AVRKRYWARNFVGWPKFSATQPNATHHALARFEREERVQAVVTQNVDRLHT 141
            ..:::.|..     |:.:..:...|         :|...|:.:...:.:..::...:||:|.|..
Zfish   117 FQIDYFKKHPEPFFALARELYPGQF---------KPTVYHYFIKMLKDKGLLRRCYSQNIDTLER 172

  Fly   142 KAG--SRNVVEVHGSGYVVKCLS--C--EYRIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPL 200
            .||  ..:::|.||:.:...|:|  |  ||.:|..:        |..|.:               
Zfish   173 VAGLEGEDLIEAHGTFHTSHCVSFLCRKEYSMDWMK--------NQIFSE--------------- 214

  Fly   201 EYIENFRIPECTQCGGDLKPEIVFFGDSVPRPRVDQIAGMVYNSDGLLVLGSSLLVFSGYRVVLQ 265
                  .||:|..||..:||:|||||:|:|......:.......|.|:::|:||.|.....:|.:
Zfish   215 ------EIPKCDSCGSLVKPDIVFFGESLPSRFFTSMKADFPQCDLLIIMGTSLQVQPFASLVSR 273

  Fly   266 TKDLKLPVGIVNIGET 281
            ..: :.|..::|:.:|
Zfish   274 VSN-RCPRLLINMEKT 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 66/263 (25%)
sirt2NP_955890.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
SIRT1 75..328 CDD:238699 64/253 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 349..379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.