DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and Sirt7

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_008766699.1 Gene:Sirt7 / 303745 RGDID:1305876 Length:426 Species:Rattus norvegicus


Alignment Length:337 Identity:89/337 - (26%)
Similarity:139/337 - (41%) Gaps:91/337 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TSLRSSTARQEYVPHHKPVVEDD-------IKRLEDFLLSKPNVLVLTGAGISTESGIPDYRS-E 68
            |.|:..:.|:|.:...:..|.||       ::.|...:.|..:::|.|||||||.:.|||||. .
  Rat    60 TELQGRSRRREGLKRRQEEVCDDPEELRRKVRELAGAVRSARHLVVYTGAGISTAASIPDYRGPN 124

  Fly    69 GVGLYARSNHKPVQHMEFVKSSAVRKRYWARNFVGWPKFSATQPNATHHALARFEREERVQAVVT 133
            ||....:.. :||...:                     .|..:|..||.::.:..:.:.||.||:
  Rat   125 GVWTLLQKG-RPVSAAD---------------------LSEAEPTLTHMSITQLHKHKLVQHVVS 167

  Fly   134 QNVDRLHTKAG-SRNVV-EVHGSGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDV 196
            ||.|.||.::| .|..: |:||:.|:.  :|...|.     |.:                  ||.
  Rat   168 QNCDGLHLRSGLPRTAISELHGNMYIE--VSSAQRT-----QGL------------------GDK 207

  Fly   197 EIPL----------------EYIENFRIPE------------CTQCGGDLKPEIVFFGD--SVPR 231
            ::.|                ||:..|.:.|            |.:||..|:..||.||:  ::.:
  Rat   208 QMSLTVPSLPQVCTSCIPNREYVRVFDVTERTALHRHLTGRTCHKCGTQLRDTIVHFGERGTLGQ 272

  Fly   232 P-RVDQIAGMVYNSDGLLVLGSSLLVFSGY-RVVLQTK--DLKLPVGIVNIGETRADHLADIKIS 292
            | ..:........:|.:|.|||||.|...| |:...||  ..:..:.|||:..|..|..|.:|:.
  Rat   273 PLNWEAATEAASKADTILCLGSSLKVLKKYPRLWCMTKPPSRRPKLYIVNLQWTPKDDWAALKLH 337

  Fly   293 AKCGDVIPKLFD 304
            .||.||:..|.|
  Rat   338 GKCDDVMRLLMD 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 79/297 (27%)
Sirt7XP_008766699.1 SIRT7 102..339 CDD:238701 74/283 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.