DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and Sirt6

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001026819.1 Gene:Sirt6 / 299638 RGDID:1305216 Length:330 Species:Rattus norvegicus


Alignment Length:288 Identity:74/288 - (25%)
Similarity:120/288 - (41%) Gaps:68/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VEDDIKRLEDFLLSKPNVLVLTGAGISTESGIPDYRS-EGVGLYARSNHKPVQHMEFVKSSAVRK 94
            :|..:..|...:.....|:..|||||||.|||||:|. .||                        
  Rat    30 LECKVWELARLMWQSSTVVFHTGAGISTASGIPDFRGPHGV------------------------ 70

  Fly    95 RYWARNFVGW-PKFSAT----QPNATHHALARFEREERVQAVVTQNVDRLHTKAG--SRNVVEVH 152
              |.....|. |||..|    :|:.||.||.:.||...:..:|:||||.||.::|  ...:.|:|
  Rat    71 --WTMEERGLAPKFDITFENARPSKTHMALVQLERMGFLSFLVSQNVDGLHVRSGFPRDKLAELH 133

  Fly   153 GSGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPLEYIENFRIPECT----- 212
            |:.:|.:|..|:.:..|   .:::.::.         ::..|.:              ||     
  Rat   134 GNMFVEECPKCKTQYVR---DTVVGTMG---------LKATGRL--------------CTVAKAR 172

  Fly   213 ---QCGGDLKPEIVFFGDSVPRPRVDQIAGMVYNSDGLLVLGSSLLVFSGYRVVLQTKDLKLPVG 274
               .|.|:|:..|:.:.|::|...:.........:|..:.||:||.:.....:.|.||.....:.
  Rat   173 GLRACRGELRDTILDWEDALPDRDLTLADEASRTADLSVTLGTSLQIRPSGNLPLATKRRGGRLV 237

  Fly   275 IVNIGETRADHLADIKISAKCGDVIPKL 302
            |||:..|:.|..||:.|.....:|:.||
  Rat   238 IVNLQPTKHDRQADLCIHGYVDEVMCKL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 70/276 (25%)
Sirt6NP_001026819.1 SIRT7 45..257 CDD:238701 69/263 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.