DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and Sirt3

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_006230588.1 Gene:Sirt3 / 293615 RGDID:1308374 Length:334 Species:Rattus norvegicus


Alignment Length:264 Identity:75/264 - (28%)
Similarity:116/264 - (43%) Gaps:54/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VLVLTGAGISTESGIPDYRSEGVGLYARSNHKPVQHMEFVKSSAVRKRYWARNFVGWPKFSAT-- 110
            |:|:.||||||.|||||:||.|.|||:......:.:.|.:    ....::..|    ||...|  
  Rat    75 VVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAI----FELGFFFHN----PKPFFTLA 131

  Fly   111 --------QPNATHHALARFEREERVQAVVTQNVDRLHTKAG--SRNVVEVHGSGYVVKCLSCEY 165
                    :||..|:.|.....:|.:..:.|||:|.|...:|  :..:||.|||.....|..|  
  Rat   132 KELYPGHYRPNVAHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVEAHGSFVSATCTVC-- 194

  Fly   166 RIDRHEFQSILASLNPAFKDAPDMIRPDGDVEIPLEYIENFRIPECTQCGGDLKPEIVFFGDSVP 230
               |..|..             :.||.|         :...|:|.|..|.|.:||:|||||:.:|
  Rat   195 ---RRSFPG-------------EDIRAD---------VMADRVPRCPVCTGVVKPDIVFFGEQLP 234

  Fly   231 RPRVDQIAGMVYNSDGLLVLGSSLLVFSGYRVVLQTKDLKLPVGIVNIGETRADHLADIKISAKC 295
            ...:..:|.... :|.||:||:||.| ..:..:.::....:|..::|     .|.:....:|.:.
  Rat   235 ARFLLHVADFAL-ADLLLILGTSLEV-EPFASLSESVQKSVPRLLIN-----RDLVGSFALSPRR 292

  Fly   296 GDVI 299
            .||:
  Rat   293 KDVV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 74/262 (28%)
Sirt3XP_006230588.1 SIRT1 74..308 CDD:238699 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.