DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt4 and SIRT5

DIOPT Version :9

Sequence 1:NP_572241.2 Gene:Sirt4 / 31480 FlyBaseID:FBgn0029783 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001363727.1 Gene:SIRT5 / 23408 HGNCID:14933 Length:310 Species:Homo sapiens


Alignment Length:318 Identity:87/318 - (27%)
Similarity:151/318 - (47%) Gaps:51/318 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SSTARQEYVPHHKPVVEDDIKRLEDFLLSKPNVLVLTGAGISTESGIPDYRSEGVGLYARS---- 76
            :||..|..:...:|  ...:.....|.....::::::|||:|.|||:|.:|  |.|.|.|.    
Human    23 ASTRNQICLKMARP--SSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFR--GAGGYWRKWQAQ 83

  Fly    77 --------NHKPVQHMEFVKSSAVRKRYWARNFVGWPKFSATQPNATHHALA----RFEREERVQ 129
                    .|.|.:..||.        ::.|..:|     :.:|||.|.|:|    |..::.|..
Human    84 DLATPLAFAHNPSRVWEFY--------HYRREVMG-----SKEPNAGHRAIAECETRLGKQGRRV 135

  Fly   130 AVVTQNVDRLHTKAGSRNVVEVHGSGYVVKCLSCEYRIDRHEFQSILASLNPAF--KDAPDMIRP 192
            .|:|||:|.||.|||::|::|:|||.:..:|.||....:.::     :.:.||.  |.||:   |
Human   136 VVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYK-----SPICPALSGKGAPE---P 192

  Fly   193 -DGDVEIPLEYIENFRIPECTQ--CGGDLKPEIVFFGDSVPRPRVDQIAGMVYNSDGLLVLGSSL 254
             ..|..||:|     ::|.|.:  |||.|:|.:|:||:::....::::...:.:.|..||:|:|.
Human   193 GTQDASIPVE-----KLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSS 252

  Fly   255 LVFSGYRVVLQTKDLKLPVGIVNIGETRADHLADIKISAKCGDVIPKLFDFRNSKSVS 312
            :|:.......|.....:||...|...|.|.:.........||..:|:......:::||
Human   253 VVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt4NP_572241.2 SIRT4 38..299 CDD:238700 80/281 (28%)
SIRT5NP_001363727.1 SIRT5_Af1_CobB 51..301 CDD:238703 80/277 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.