DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pop1 and CG5455

DIOPT Version :9

Sequence 1:NP_572236.3 Gene:Pop1 / 31475 FlyBaseID:FBgn0026702 Length:857 Species:Drosophila melanogaster
Sequence 2:NP_651481.1 Gene:CG5455 / 43196 FlyBaseID:FBgn0039430 Length:688 Species:Drosophila melanogaster


Alignment Length:350 Identity:69/350 - (19%)
Similarity:103/350 - (29%) Gaps:137/350 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 LTSPQCGLGITARTFLSGRREGSV------ELFEDGRYPYGALQRASFMWRPRREEEDEKQTNHT 248
            |..|..|..|.|...|.....||:      .|:::.|.|      ..|...||......|:..|:
  Fly   266 LAEPPPGQPIRADIVLIHGLHGSLVNTWKQGLWQNDRQP------VEFERPPRPPVRPPKRPRHS 324

  Fly   249 LWLWLHPSGAQAVLNQLISVFQLKSTRQQKLPLNEAVTEEKMDVDKIEPVELSKETSPGKKNSKK 313
            ....:||:.              :..|.:...||..     ||.                     
  Fly   325 RSAAIHPAP--------------REKRAKFASLNRC-----MDT--------------------- 349

  Fly   314 KPEQRPLRFWTK-TKAFDPQPSYF-----NSDGTLHLVL------------LQREFNRFRLTGPR 360
             |:..|:|..|: .|:...||..|     :||.:.:..:            ::..|..|||    
  Fly   350 -PDDSPVRRRTRLQKSMPMQPEDFQINASDSDDSDYAYVCGEPEEIQICEGIEYSFPTFRL---- 409

  Fly   361 AQKVLFASLRPHREEELQDKANYCQAALQLSSPAELLSNLVMAHLVVD---------PRLQRPKK 416
                           .:||.:...||.|:         :::.|:...:         ||...|..
  Fly   410 ---------------RMQDNSRLLQAELE---------SMLQANGNEEGGTNGKDNRPRPPSPAT 450

  Fly   417 RTKAVGKMEQPPLS-------AGDLLMNQPKSLPE---------------SPLW-SKKARERLAK 458
            ..||..|.:..|..       .||.|   |...|.               .||| ||:.|..|  
  Fly   451 PRKAARKSKPSPNDPNYSKCWPGDWL---PLDCPGVRVIALNYTTDQYLWRPLWKSKEPRSSL-- 510

  Fly   459 GIMSAHKYDQLREQHAVVPGAPCAF 483
             |..:.:..:|..||.|..|.|..:
  Fly   511 -IQRSREMAELLIQHRVGHGRPIIY 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pop1NP_572236.3 POP1 33..178 CDD:284413
POPLD 514..600 CDD:285393
CG5455NP_651481.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.