DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and MYL10

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_612412.2 Gene:MYL10 / 93408 HGNCID:29825 Length:226 Species:Homo sapiens


Alignment Length:135 Identity:32/135 - (23%)
Similarity:65/135 - (48%) Gaps:4/135 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDERISFEVFLPIYQAISKARS 84
            :||.:.|...||.|....:.:...|||:...:::..:...:..|.. |:|.|||.::.  .|.:.
Human    91 QAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGP-INFTVFLTMFG--EKLKG 152

  Fly    85 GDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANM-EDQQGNINYEEFVR 148
            .|..:..:...:.||.:..|::.:..::..|.|..::.::|||:|:.|.. .|..||::|.....
Human   153 TDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCY 217

  Fly   149 MVMSG 153
            ::..|
Human   218 VITHG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 31/132 (23%)
MYL10NP_612412.2 FRQ1 40..223 CDD:227455 32/135 (24%)
EF-hand motif 89..118 CDD:320054 8/26 (31%)
EF-hand motif 149..187 CDD:320054 7/37 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.