DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and Cetn2

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_215222.5 Gene:Cetn2 / 84593 RGDID:620247 Length:255 Species:Rattus norvegicus


Alignment Length:138 Identity:44/138 - (31%)
Similarity:80/138 - (57%) Gaps:5/138 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPD--ERISFEVFLPIYQA 78
            :|.:|||:|||..|.|.|.:.::...:||||..|.:.::||...::..:  .:::|..||.:  .
  Rat   114 QEIREAFDLFDADGTGTIDMKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFSDFLTV--M 176

  Fly    79 ISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANME-DQQGNIN 142
            ..|....||.::.::..:.||.|.:|.||...|:.:...|||.|||||:::::...: |..|.:|
  Rat   177 TQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVN 241

  Fly   143 YEEFVRMV 150
            .:||:|::
  Rat   242 EQEFLRIM 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 44/138 (32%)
Cetn2XP_215222.5 PTZ00183 99..255 CDD:185503 44/138 (32%)
EFh 115..177 CDD:238008 20/63 (32%)
EFh 188..250 CDD:238008 21/62 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.