DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and AT1G32250

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_174504.1 Gene:AT1G32250 / 840117 AraportID:AT1G32250 Length:166 Species:Arabidopsis thaliana


Alignment Length:147 Identity:44/147 - (29%)
Similarity:73/147 - (49%) Gaps:11/147 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPT----ESDVKKCTHQLKPDERISFEVFL-- 73
            :.|.:|.|..||...||.:...::|..|||||..|:    |:.:.|.  ..|.:..:.|..|:  
plant    14 INELREIFRSFDRNKDGSLTQLELGSLLRALGVKPSPDQFETLIDKA--DTKSNGLVEFPEFVAL 76

  Fly    74 --PIYQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANME- 135
              |...:.:|..:..|.:..:...|.||.|.:|:|::|||.|.:..||..||..|:..::...: 
plant    77 VSPELLSPAKRTTPYTEEQLLRLFRIFDTDGNGFITAAELAHSMAKLGHALTVAELTGMIKEADS 141

  Fly   136 DQQGNINYEEFVRMVMS 152
            |..|.||::||.:.:.|
plant   142 DGDGRINFQEFAKAINS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 43/145 (30%)
AT1G32250NP_174504.1 PTZ00184 8..158 CDD:185504 43/145 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.