DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and AT3G25600

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_189188.4 Gene:AT3G25600 / 822147 AraportID:AT3G25600 Length:161 Species:Arabidopsis thaliana


Alignment Length:150 Identity:34/150 - (22%)
Similarity:63/150 - (42%) Gaps:33/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLK----------------- 62
            :::.::.|..||...||.:...::...||:||..|....:....:|:.                 
plant    10 IKQLKDIFARFDMDKDGSLTQLELAALLRSLGIKPRGDQISLLLNQIDRNGNGSVEFDELVVAIL 74

  Fly    63 PDERISFEVFLPIYQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEV 127
            ||  |:.||.:             ..:..:|..|.||:|.:|.|::|||...:..:|..||..|:
plant    75 PD--INEEVLI-------------NQEQLMEVFRSFDRDGNGSITAAELAGSMAKMGHPLTYREL 124

  Fly   128 EQLLANMEDQ-QGNINYEEF 146
            .:::...:.. .|.|::.||
plant   125 TEMMTEADSNGDGVISFNEF 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 33/149 (22%)
AT3G25600NP_189188.4 PTZ00184 1..148 CDD:185504 33/149 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.