DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and AT2G41090

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_181642.1 Gene:AT2G41090 / 818708 AraportID:AT2G41090 Length:191 Species:Arabidopsis thaliana


Alignment Length:147 Identity:51/147 - (34%)
Similarity:86/147 - (58%) Gaps:8/147 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQTFTTLEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTH--QLKPDERISFEV 71
            |.|...:.||:|.|:::|..|||.|...:.|..:|:||.|.|::::::..:  .|..|..|:|..
plant     4 KFTRQQISEFREQFSVYDKNGDGHITTEEFGAVMRSLGLNLTQAELQEEINDSDLDGDGTINFTE 68

  Fly    72 FLPIYQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANME- 135
            ||     .:.|:...:..|..:..|.||.|.:|:||:||:|::.|.|..|.||||:::::...: 
plant    69 FL-----CAMAKDTYSEKDLKKDFRLFDIDKNGFISAAEMRYVRTILRWKQTDEEIDEIIKAADV 128

  Fly   136 DQQGNINYEEFVRMVMS 152
            |..|.|||.||.|::|:
plant   129 DGDGQINYREFARLMMA 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 48/140 (34%)
AT2G41090NP_181642.1 PTZ00184 1..146 CDD:185504 51/147 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.