DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and myl6

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_005166134.1 Gene:myl6 / 798632 ZFINID:ZDB-GENE-041010-28 Length:164 Species:Danio rerio


Alignment Length:132 Identity:70/132 - (53%)
Similarity:91/132 - (68%) Gaps:4/132 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDE----RISFEVFLPIYQ 77
            ||:|||.|||..|||||..:|.|:.:|||||||..::|.|.......::    .:.||.|||:.|
Zfish    11 EFKEAFLLFDRTGDGKIMYNQCGDVMRALGQNPVNAEVLKVLGNPSNEDMNMKMLDFEQFLPMLQ 75

  Fly    78 AISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQQGNIN 142
            ||:|.:...:.:||:||||.|||:.:|.:..|||||:|||||||:|:||||.|||..||..|.||
Zfish    76 AIAKNKDQGSFEDFVEGLRVFDKEGNGTVMGAELRHVLTTLGEKMTEEEVETLLAGHEDANGCIN 140

  Fly   143 YE 144
            ||
Zfish   141 YE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 70/132 (53%)
myl6XP_005166134.1 EFh 11..94 CDD:298682 37/82 (45%)
EF-hand_6 11..40 CDD:290141 17/28 (61%)
EFh 88..142 CDD:238008 35/53 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596218
Domainoid 1 1.000 42 1.000 Domainoid score I12435
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H69080
Inparanoid 1 1.050 162 1.000 Inparanoid score I4192
OMA 1 1.010 - - QHG52059
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 1 1.000 - - otm24390
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X268
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.