DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and Myl4

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001102965.1 Gene:Myl4 / 688228 RGDID:1591197 Length:193 Species:Rattus norvegicus


Alignment Length:154 Identity:80/154 - (51%)
Similarity:106/154 - (68%) Gaps:8/154 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKQTFTT--LEEFQEAFNLFDN--RGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDE--- 65
            ||..|:.  :|||:|||:|||.  .|:.||...|.|:.|||||||||.::|.:...:.||:|   
  Rat    40 VKIDFSADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNS 104

  Fly    66 -RISFEVFLPIYQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQ 129
             .:.||:||||.|.||:.:...|.:||:||||.|||:::|.:..|||||:|.|||||:::.||||
  Rat   105 KTLDFEMFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMSEAEVEQ 169

  Fly   130 LLANMEDQQGNINYEEFVRMVMSG 153
            ||...||..|.||||.||:.||||
  Rat   170 LLTGQEDANGCINYEAFVKHVMSG 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 74/145 (51%)
Myl4NP_001102965.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
PTZ00184 45..192 CDD:185504 74/146 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354002
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4115
OMA 1 1.010 - - QHG52059
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 1 1.000 - - otm44700
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23048
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X268
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.