DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and MYL7

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_011513765.1 Gene:MYL7 / 58498 HGNCID:21719 Length:231 Species:Homo sapiens


Alignment Length:169 Identity:38/169 - (22%)
Similarity:62/169 - (36%) Gaps:39/169 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EAFNLFDNRGDGKIQLSQVGECLRALGQ-NPTESDVKKCTHQLKPDERISFEVFLPIYQAISKAR 83
            :||:..|...||.|..:.:.|....||: :..|.::.....:.|..  |:|.|||.::.  .|..
Human    62 QAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGP--INFTVFLTLFG--EKLN 122

  Fly    84 SGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEE---------------------- 126
            ..|..:..:...|.||....|.::..|.:.||.|..:|.:..|                      
Human   123 GTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVRLPSPFNTHPQHLLWAFTHDP 187

  Fly   127 -----------VEQLLA-NMEDQQGNINYEEFVRMVMSG 153
                       |||:.| ...|..|||:|:....::..|
Human   188 EPSTSEAVAGRVEQMFALTPMDLAGNIDYKSLCYIITHG 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 37/166 (22%)
MYL7XP_011513765.1 EF-hand_7 62..154 CDD:290234 23/95 (24%)
EF-hand_8 72..157 CDD:290545 22/88 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.