DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and myl4

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001020354.1 Gene:myl4 / 574004 ZFINID:ZDB-GENE-050626-112 Length:187 Species:Danio rerio


Alignment Length:154 Identity:73/154 - (47%)
Similarity:104/154 - (67%) Gaps:8/154 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKQTFTT--LEEFQEAFNLFDN--RGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDE--- 65
            :|..||.  :|||:|.|.|||.  ..:.||..:|.|:.:||||.|||.::|.|...:.:|:|   
Zfish    34 IKVGFTADQIEEFKETFMLFDRTPASEMKITYAQCGDVMRALGLNPTNAEVLKVLGKPRPEEMNT 98

  Fly    66 -RISFEVFLPIYQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQ 129
             .|.||.|||::|.:|:::...|.:||:||||.|||:.:|.:..|||||:|.|||||:|:.||||
Zfish    99 KMIDFETFLPMFQHVSRSKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTESEVEQ 163

  Fly   130 LLANMEDQQGNINYEEFVRMVMSG 153
            |:|..||..|.:|||.||:.:|:|
Zfish   164 LMAGQEDGNGCVNYEAFVKHIMAG 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 68/145 (47%)
myl4NP_001020354.1 PTZ00184 39..186 CDD:185504 69/146 (47%)
EFh 124..185 CDD:238008 36/60 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596223
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4192
OMA 1 1.010 - - QHG52059
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 1 1.000 - - otm24390
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X268
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.