DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and calml4

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001011117.1 Gene:calml4 / 496530 XenbaseID:XB-GENE-5936220 Length:153 Species:Xenopus tropicalis


Alignment Length:139 Identity:49/139 - (35%)
Similarity:73/139 - (52%) Gaps:5/139 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKK--CTHQLKPDERISFEVFLPIYQ 77
            :::|:|.|:|:|.:|.|||....:...:|.||..||..:|.:  ..|::..|..:.|..||.|..
 Frog    10 IQKFKECFSLYDKKGKGKIPAGDLLTVMRCLGTCPTPGEVTRHLQVHKIGKDGEVDFSTFLTIMY 74

  Fly    78 AISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANME-DQQGNI 141
            ...|..  |..::.:..:...||...|.|...|||..||.:|||||.|||:.||..:: ...|.:
 Frog    75 RQQKQE--DPENEIMVAMLMSDKQKKGVIPLKELRAKLTQMGEKLTPEEVDDLLKGVKVGPDGMV 137

  Fly   142 NYEEFVRMV 150
            .||||||.:
 Frog   138 KYEEFVRQI 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 49/139 (35%)
calml4NP_001011117.1 PTZ00184 1..144 CDD:185504 47/135 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.