DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and myl6

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_989137.1 Gene:myl6 / 394742 XenbaseID:XB-GENE-5931386 Length:151 Species:Xenopus tropicalis


Alignment Length:143 Identity:69/143 - (48%)
Similarity:98/143 - (68%) Gaps:4/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDE----RISFEVFLPI 75
            :.:::|:|.|||..|||||...|.|:.:||||||||.::|.|.....||::    .:.||.|||:
 Frog     9 IADYKESFQLFDRVGDGKILFGQCGDVMRALGQNPTNAEVMKVLGNPKPEDMNIKTLDFEQFLPM 73

  Fly    76 YQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQQGN 140
            .|.::|.|.....:|.|||||.|||:.:|.:..:||||:|.:||||:||:|||.||:|.||..|.
 Frog    74 MQTVAKNRDVPGLEDIIEGLRVFDKEGNGTVMGSELRHVLVSLGEKMTDDEVETLLSNHEDANGC 138

  Fly   141 INYEEFVRMVMSG 153
            |||||.:|.:::|
 Frog   139 INYEELIRAILNG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 68/140 (49%)
myl6NP_989137.1 EFh_PEF 5..146 CDD:330173 67/136 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H69080
Inparanoid 1 1.050 151 1.000 Inparanoid score I4246
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 1 1.000 - - otm47740
Panther 1 1.100 - - O PTHR23048
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X268
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.