DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and cabp5a

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_956992.1 Gene:cabp5a / 393671 ZFINID:ZDB-GENE-040426-1655 Length:165 Species:Danio rerio


Alignment Length:147 Identity:43/147 - (29%)
Similarity:77/147 - (52%) Gaps:12/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPD--ERISFEVFLPIYQ 77
            :||.:||||.||...||.|....:|..:|.:|..|||.::.:....:..:  .|:.||.|:   :
Zfish    21 IEELREAFNEFDKDKDGLISCKDLGNLMRTMGYMPTEMELIELGQNINMNLGGRVDFEDFV---E 82

  Fly    78 AISKARSGDTA-----DDFIEGLRHFDKDASGYISSAELRHLLT-TLGEKLTDEEVEQLLANMED 136
            .::.....:||     .:..:..:.||.|..|.|::.|||..:| .|||.:...|::.::...::
Zfish    83 LMTPKLLAETAGMIGVKELRDAFKEFDMDGDGAITTEELRCAMTKLLGEHMNRREIDAVVREADN 147

  Fly   137 Q-QGNINYEEFVRMVMS 152
            . .|.:::||||:|:.|
Zfish   148 NGDGTVDFEEFVKMLSS 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 42/145 (29%)
cabp5aNP_956992.1 PTZ00184 15..164 CDD:185504 42/145 (29%)
EFh 23..85 CDD:238008 20/64 (31%)
EFh 100..163 CDD:238008 19/62 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.