DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and myl13

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_956810.1 Gene:myl13 / 393488 ZFINID:ZDB-GENE-040426-1593 Length:186 Species:Danio rerio


Alignment Length:159 Identity:73/159 - (45%)
Similarity:106/159 - (66%) Gaps:8/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YYTAHVKQTFTT--LEEFQEAFNLFDN--RGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKP 63
            :..|.|:..||.  :|:|::||.|||.  ..:.||..:|.|:.:||||||||.::|.....:.||
Zfish    28 FNAAEVQIEFTAEQIEDFKDAFQLFDRTPTNEMKITFAQCGDLIRALGQNPTNAEVLHVLGKPKP 92

  Fly    64 DE----RISFEVFLPIYQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTD 124
            ::    .:.|:.|||::|.|.||:...|.:||:||||.|||:.:|.:..|||||:|.|||||:.:
Zfish    93 EDMQVKMLDFDQFLPMHQHICKAKDRGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKE 157

  Fly   125 EEVEQLLANMEDQQGNINYEEFVRMVMSG 153
            :|||||:|..||..|.||||.||:.:|:|
Zfish   158 DEVEQLMAGQEDANGCINYEAFVKHIMAG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 67/145 (46%)
myl13NP_956810.1 PTZ00184 34..185 CDD:185504 69/150 (46%)
EFh 123..184 CDD:238008 36/60 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596220
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4192
OMA 1 1.010 - - QHG52059
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 1 1.000 - - otm24390
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X268
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.