DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and Cabp5

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001102377.1 Gene:Cabp5 / 365194 RGDID:1308108 Length:173 Species:Rattus norvegicus


Alignment Length:145 Identity:42/145 - (28%)
Similarity:78/145 - (53%) Gaps:12/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPD--ERISFEVFLPIYQ 77
            ::|.:|||..||...||.|....:|..:|.:|..|||.::.:...|::.:  .|:.||.|:   :
  Rat    30 IDELREAFLEFDKDRDGFISYKDLGNLMRTMGYMPTEMELTELGQQIRMNLGGRVDFEDFV---E 91

  Fly    78 AISKARSGDTA-----DDFIEGLRHFDKDASGYISSAELRHLL-TTLGEKLTDEEVEQLLANME- 135
            .::.....:||     .:..:..:.||.:..|.|:.|||:..: ..||||||..|:.:::...: 
  Rat    92 LMTPKLLAETAGMIGVQEMRDAFKEFDANGDGEITLAELQQAMQRLLGEKLTPREIAEVVQEADI 156

  Fly   136 DQQGNINYEEFVRMV 150
            :..|.:::||||:|:
  Rat   157 NGDGTVDFEEFVKMM 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 42/145 (29%)
Cabp5NP_001102377.1 PTZ00184 25..171 CDD:185504 41/143 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.