DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and Myl6l

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001094453.2 Gene:Myl6l / 362816 RGDID:1305620 Length:151 Species:Rattus norvegicus


Alignment Length:141 Identity:76/141 - (53%)
Similarity:99/141 - (70%) Gaps:4/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDER----ISFEVFLPIYQ 77
            ||:|||.|||..|||||..||.|:.:||||||||.::|.|.....|.||.    :.||.|||:.|
  Rat    11 EFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQ 75

  Fly    78 AISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQQGNIN 142
            .::|.:...|.:|::||||.|||:.:|.:..||:||:|.|||||:|:||||.|:|..||..|.||
  Rat    76 TVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCIN 140

  Fly   143 YEEFVRMVMSG 153
            |||.||||::|
  Rat   141 YEELVRMVLNG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 75/138 (54%)
Myl6lNP_001094453.2 PTZ00184 5..149 CDD:185504 74/137 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I11976
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4115
OMA 1 1.010 - - QHG52059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 1 1.000 - - otm44700
orthoMCL 1 0.900 - - OOG6_103928
Panther 1 1.100 - - O PTHR23048
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X268
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.060

Return to query results.
Submit another query.