DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and zgc:153867

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_017209013.1 Gene:zgc:153867 / 337226 ZFINID:ZDB-GENE-030131-9170 Length:209 Species:Danio rerio


Alignment Length:154 Identity:84/154 - (54%)
Similarity:104/154 - (67%) Gaps:13/154 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TTLE---------EFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDER-- 66
            :|||         ||:|||.|||..|||||..:|.|:.:|||||||..::|.|.....|.:|.  
Zfish    56 STLESDFSEDQILEFKEAFLLFDRTGDGKITYNQCGDVMRALGQNPVNAEVLKVLGNPKAEEMNH 120

  Fly    67 --ISFEVFLPIYQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQ 129
              :.||.|||:.|||:|.:...|.:||:||||.|||:.:|.:..|||||:|||||||:|:||||.
Zfish   121 KLLDFEQFLPMLQAIAKNKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLTTLGEKMTEEEVET 185

  Fly   130 LLANMEDQQGNINYEEFVRMVMSG 153
            |||..||..|.|||||.|||||||
Zfish   186 LLAGHEDANGCINYEELVRMVMSG 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 81/150 (54%)
zgc:153867XP_017209013.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596219
Domainoid 1 1.000 42 1.000 Domainoid score I12435
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H69080
Inparanoid 1 1.050 162 1.000 Inparanoid score I4192
OMA 1 1.010 - - QHG52059
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 1 1.000 - - otm24390
orthoMCL 1 0.900 - - OOG6_103928
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4661
SonicParanoid 1 1.000 - - X268
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.