DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and CG17493

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster


Alignment Length:137 Identity:49/137 - (35%)
Similarity:80/137 - (58%) Gaps:5/137 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPD--ERISFEVFLPIYQAI 79
            :.:|||:||||.|.|.|::.::...:||||..|.:.::|:....:..|  .||:|.|||.:... 
  Fly    42 DIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMISDIDKDCSGRIAFNVFLQLMTI- 105

  Fly    80 SKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANME-DQQGNINY 143
             |....||.::.::..|.||.|.:|.||...|:.:...|||.|||||:.:::...: |..|.:|.
  Fly   106 -KMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGETLTDEELREMIDEADLDNDGEVNQ 169

  Fly   144 EEFVRMV 150
            |||:|::
  Fly   170 EEFLRIM 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 49/137 (36%)
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 49/137 (36%)
EFh 42..104 CDD:238008 23/61 (38%)
EFh 115..177 CDD:238008 23/62 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.