DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and CG31802

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_724103.1 Gene:CG31802 / 318949 FlyBaseID:FBgn0051802 Length:186 Species:Drosophila melanogaster


Alignment Length:138 Identity:45/138 - (32%)
Similarity:79/138 - (57%) Gaps:7/138 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDE--RISFEVFLPIYQAI 79
            :.::||:|||.:..|.|:..::...:||||..|.:.|:|:...::..|:  ||:|..||  |...
  Fly    46 DIKKAFDLFDTQCTGFIETKELRVAIRALGFEPKKEDIKRMMDEIDKDKTGRIAFNDFL--YLMR 108

  Fly    80 SKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLL--ANMEDQQGNIN 142
            .|....|:..|.::....||.|.:|.||...|:.:...|||:|||||:::::  ||:.. .|.::
  Fly   109 LKMAEKDSNQDMMKAFSFFDDDRTGGISFLNLKRVAKELGEQLTDEELQEMIDEANVSG-DGEVS 172

  Fly   143 YEEFVRMV 150
            .|||:.::
  Fly   173 KEEFLNLI 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 45/138 (33%)
CG31802NP_724103.1 PTZ00183 38..185 CDD:185503 45/138 (33%)
EFh 46..108 CDD:238008 21/63 (33%)
EFh 119..181 CDD:238008 22/63 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.